HNF1A Antibody - N-terminal region : FITC

HNF1A Antibody - N-terminal region : FITC
SKU
AVIARP57904_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A

Key Reference: Eide,S.A., (er) Diabet. Med. (2008) In press

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hepatocyte nuclear factor 1-alpha

Protein Size: 631

Purification: Affinity Purified
More Information
SKU AVIARP57904_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57904_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6927
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×