HNF1A Antibody - N-terminal region : HRP

HNF1A Antibody - N-terminal region : HRP
SKU
AVIARP57904_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A

Key Reference: Eide,S.A., (er) Diabet. Med. (2008) In press

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hepatocyte nuclear factor 1-alpha

Protein Size: 631

Purification: Affinity Purified
More Information
SKU AVIARP57904_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57904_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6927
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×