HOOK2 Antibody - middle region : Biotin

HOOK2 Antibody - middle region : Biotin
SKU
AVIARP54934_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human HOOK2

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: LRRAGSLRAQLEAQRRQVQELQGQRQEEAMKAEKWLFECRNLEEKYESVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Hook homolog 2

Protein Size: 719

Purification: Affinity purified
More Information
SKU AVIARP54934_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54934_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29911
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×