HOXA7 Antibody - C-terminal region : HRP

HOXA7 Antibody - C-terminal region : HRP
SKU
AVIARP58017_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HOXA7

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: IKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Homeobox protein Hox-A7

Protein Size: 230

Purification: Affinity Purified
More Information
SKU AVIARP58017_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58017_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3204
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×