HOXC8 Antibody - middle region : Biotin

HOXC8 Antibody - middle region : Biotin
SKU
AVIARP57869_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXC8

Key Reference: Kikugawa,T., (2006) Prostate 66 (10), 1092-1099

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: SVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox protein Hox-C8

Protein Size: 242

Purification: Affinity Purified
More Information
SKU AVIARP57869_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57869_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3224
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×