HOXD12 Antibody - middle region : HRP

HOXD12 Antibody - middle region : HRP
SKU
AVIARP58025_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters,

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXD12

Key Reference: 0

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: AELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLRE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Homeobox protein Hox-D12

Protein Size: 279

Purification: Affinity Purified
More Information
SKU AVIARP58025_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58025_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3238
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×