HP1BP3 Antibody - middle region : Biotin

HP1BP3 Antibody - middle region : Biotin
SKU
AVIARP56875_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HP1BP3

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heterochromatin protein 1-binding protein 3

Protein Size: 553

Purification: Affinity Purified
More Information
SKU AVIARP56875_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56875_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 50809
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×