HS1BP3 Antibody - N-terminal region : FITC

HS1BP3 Antibody - N-terminal region : FITC
SKU
AVIARP57633_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HS1BP3

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HCLS1-binding protein 3

Protein Size: 392

Purification: Affinity Purified
More Information
SKU AVIARP57633_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57633_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64342
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×