HSPA2 Antibody - middle region : Biotin

HSPA2 Antibody - middle region : Biotin
SKU
AVIARP55382_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HSPA2 belongs to the heat shock protein 70 family.In cooperation with other chaperones, HSPA2 stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPA2

Key Reference: Lee,S.H., (er) Dig. Dis. Sci. (2007) In press

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heat shock-related 70 kDa protein 2

Protein Size: 639

Purification: Affinity Purified
More Information
SKU AVIARP55382_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55382_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3306
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×