Hspbp1 Antibody - C-terminal region : HRP

Hspbp1 Antibody - C-terminal region : HRP
SKU
AVIARP54870_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Hspbp1 inhibits chaperone activity by preventing ATP binding.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Hspbp1

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: VLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hsp70-binding protein 1

Protein Size: 357

Purification: Affinity Purified
More Information
SKU AVIARP54870_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54870_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 246146
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×