HSPC111 Antibody - middle region : HRP

HSPC111 Antibody - middle region : HRP
SKU
AVIARP56898_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPC111

Key Reference: Scherl,A., (2002) Mol. Biol. Cell 13 (11), 4100-4109

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nucleolar protein 16

Protein Size: 178

Purification: Affinity Purified
More Information
SKU AVIARP56898_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56898_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51491
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×