HSPE1 Antibody - middle region : Biotin

HSPE1 Antibody - middle region : Biotin
SKU
AVIARP54651_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPE1

Key Reference: Ralph,S., (2007) Cancer Sci. 98 (6), 844-849

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 10 kDa heat shock protein, mitochondrial

Protein Size: 102

Purification: Affinity Purified
More Information
SKU AVIARP54651_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54651_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3336
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×