HSPE1 Antibody - middle region : HRP

HSPE1 Antibody - middle region : HRP
SKU
AVIARP54651_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPE1

Key Reference: Ralph,S., (2007) Cancer Sci. 98 (6), 844-849

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 10 kDa heat shock protein, mitochondrial

Protein Size: 102

Purification: Affinity Purified
More Information
SKU AVIARP54651_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54651_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3336
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×