HTRA4 Antibody - middle region : Biotin

HTRA4 Antibody - middle region : Biotin
SKU
AVIARP55603_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HTRA4 is a member of the HtrA family of proteases. The protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HTRA4

Key Reference: Clausen,T., (2002) Mol. Cell 10 (3), 443-455

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine protease HTRA4

Protein Size: 476

Purification: Affinity Purified
More Information
SKU AVIARP55603_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55603_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 203100
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×