IAH1 Antibody - N-terminal region : Biotin

IAH1 Antibody - N-terminal region : Biotin
SKU
AVIARP54504_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: IAH1 is probable a lipase.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human IAH1

Key Reference: N/A

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: TQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isoamyl acetate-hydrolyzing esterase 1 homolog

Protein Size: 248

Purification: Affinity purified
More Information
SKU AVIARP54504_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54504_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285148
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×