IAH1 Antibody - N-terminal region : HRP

IAH1 Antibody - N-terminal region : HRP
SKU
AVIARP54504_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: IAH1 is probable a lipase.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human IAH1

Key Reference: N/A

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: TQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Isoamyl acetate-hydrolyzing esterase 1 homolog

Protein Size: 248

Purification: Affinity purified
More Information
SKU AVIARP54504_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54504_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285148
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×