IER5L Antibody - middle region : HRP

IER5L Antibody - middle region : HRP
SKU
AVIARP55970_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IER5L

Key Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Immediate early response gene 5-like protein

Protein Size: 404

Purification: Affinity Purified
More Information
SKU AVIARP55970_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55970_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 389792
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×