IFNA5 Antibody - middle region : HRP

IFNA5 Antibody - middle region : HRP
SKU
AVIARP54652_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFNA5

Key Reference: Janssen,R., (2007) J. Infect. Dis. 196 (6), 826-834

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interferon alpha-5

Protein Size: 189

Purification: Affinity Purified
More Information
SKU AVIARP54652_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54652_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3442
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×