IFRD1 Antibody - middle region : Biotin

IFRD1 Antibody - middle region : Biotin
SKU
AVIARP54585_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFRD1

Key Reference: Batta,K. (2007) Mol. Cell. Biol. 27 (21), 7603-7614

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-related developmental regulator 1

Protein Size: 451

Purification: Affinity Purified
More Information
SKU AVIARP54585_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54585_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3475
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×