IFT122 Antibody : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence EGLDFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQG

Molecular Weight: 142 kDa

Peptide Sequence: Synthetic peptide located within the following region: EGLDFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Intraflagellar transport protein 122 homolog

Protein Size: 1241

Purification: Affinity Purified

• SKU: AVIARP53816_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53816_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Human Gene ID: 55764
• Host: Rabbit
• Conjugate: Conjugated, FITC