IL13RA2 Antibody - middle region : HRP

IL13RA2 Antibody - middle region : HRP
SKU
AVIARP53558_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL13RA2

Key Reference: Katsoulotos,G.P., (2008) J. Biol. Chem. 283 (3), 1610-1621

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interleukin-13 receptor subunit alpha-2

Protein Size: 380

Purification: Affinity Purified

Subunit: alpha-2
More Information
SKU AVIARP53558_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53558_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3598
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×