IL17D Antibody - N-terminal region : FITC

IL17D Antibody - N-terminal region : FITC
SKU
AVIARP57724_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. The treatment of endothelial cells with this cytokine has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2/ GM-CSF. The increased expression of IL8 induced by this cytokine was found to be NF-kappa B-dependent.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL17D

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-17D

Protein Size: 202

Purification: Affinity Purified
More Information
SKU AVIARP57724_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57724_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 53342
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×