IL1A Antibody - N-terminal region : Biotin

IL1A Antibody - N-terminal region : Biotin
SKU
AVIARP54322_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The IL1A protein is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. The gene encoding IL1A and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL1A

Key Reference: Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-1 alpha

Protein Size: 271

Purification: Affinity Purified
More Information
SKU AVIARP54322_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54322_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3552
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×