IL1B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL1B

Molecular Weight: 17

Peptide Sequence: Synthetic peptide located within the following region: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-1 beta

Protein Size: 269

Purification: Affinity Purified

• SKU: AVIARP54323_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54323_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rabbit, Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 3553
• Host: Rabbit
• Conjugate: Conjugated, Biotin