Il1f5 Antibody - C-terminal region : Biotin

Il1f5 Antibody - C-terminal region : Biotin
SKU
AVIARP55627_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of Il1f5 remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin 1 family, member 5 (Delta) (Predicted), isoform CRA_a EMBL EDL93666.1

Protein Size: 156

Purification: Affinity Purified
More Information
SKU AVIARP55627_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55627_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 311783
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×