IL1F5 Antibody - middle region : FITC

IL1F5 Antibody - middle region : FITC
SKU
AVIARP55628_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL1F5

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-36 receptor antagonist protein

Protein Size: 155

Purification: Affinity Purified
More Information
SKU AVIARP55628_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55628_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26525
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×