IMPA2 Antibody - middle region : FITC

IMPA2 Antibody - middle region : FITC
SKU
AVIARP58229_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IMPA2

Key Reference: Ohnishi,T., (2007) Neuropsychopharmacology 32 (8), 1727-1737

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol monophosphatase 2

Protein Size: 288

Purification: Affinity Purified
More Information
SKU AVIARP58229_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58229_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3613
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×