INPP1 Antibody - N-terminal region : HRP

INPP1 Antibody - N-terminal region : HRP
SKU
AVIARP54666_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INPP

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: inositol polyphosphate 1-phosphatase

Protein Size: 399

Purification: Affinity Purified
More Information
SKU AVIARP54666_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54666_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3628
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×