Interferon gamma Receptor 1 antibody

Interferon gamma Receptor 1 antibody
SKU
GTX02780-100
Packaging Unit
100 μg
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Application Note: WB: 0.1-0.5μg/ml. ICC/IF: 0.5-1μg/ml. IHC-Fr: 0.5-1μg/ml. FACS: 1-3μg/1x10⁶ cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 54

Form: Liquid

Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. [provided by RefSeq, Jul 2008]

Uniprot ID: P15260

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: interferon gamma receptor 1
More Information
SKU GTX02780-100
Manufacturer GeneTex
Manufacturer SKU GTX02780-100
Package Unit 100 μg
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Immunofluorescence, Immunohistochemistry (frozen), Western Blotting, Flow Cytometry, Immunocytochemistry
Isotype IgG
Human Gene ID 3459
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×