IPPK Antibody - middle region : Biotin

IPPK Antibody - middle region : Biotin
SKU
AVIARP57655_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: IPPK phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. It also protects cells from TNF-alpha-induced apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IPPK

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol-pentakisphosphate 2-kinase

Protein Size: 491

Purification: Affinity Purified
More Information
SKU AVIARP57655_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57655_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64768
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×