IQCE Antibody - middle region : HRP

IQCE Antibody - middle region : HRP
SKU
AVIARP55486_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: IQCE contains 2 IQ domains. The functions of IQCE remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IQCE

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: IQ domain-containing protein E

Protein Size: 695

Purification: Affinity Purified
More Information
SKU AVIARP55486_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55486_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23288
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×