Irf2bp1 Antibody - N-terminal region : HRP

Irf2bp1 Antibody - N-terminal region : HRP
SKU
AVIARP55314_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interferon regulatory factor 2 binding protein 1 (Predicted) EMBL EDM08246.1

Protein Size: 584

Purification: Affinity Purified
More Information
SKU AVIARP55314_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55314_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 308404
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×