ISYNA1 Antibody - N-terminal region : Biotin

ISYNA1 Antibody - N-terminal region : Biotin
SKU
AVIARP53716_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate.Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate (Seelan et al., 2004 [PubMed 15464731]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ISYNA1

Key Reference: Seelan,R.S., (2004) Arch. Biochem. Biophys. 431 (1), 95-106

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol-3-phosphate synthase 1

Protein Size: 558

Purification: Affinity Purified
More Information
SKU AVIARP53716_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53716_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51477
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×