ITPK1 Antibody - middle region : Biotin

ITPK1 Antibody - middle region : Biotin
SKU
AVIARP54994_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of A

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ITPK1

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol-tetrakisphosphate 1-kinase

Protein Size: 414

Purification: Affinity Purified
More Information
SKU AVIARP54994_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54994_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3705
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×