ITPK1 Antibody - middle region : HRP

ITPK1 Antibody - middle region : HRP
SKU
AVIARP54994_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of A

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ITPK1

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Inositol-tetrakisphosphate 1-kinase

Protein Size: 414

Purification: Affinity Purified
More Information
SKU AVIARP54994_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54994_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3705
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×