JMJD5 Antibody - middle region : Biotin

JMJD5 Antibody - middle region : Biotin
SKU
AVIARP58120_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: JMJD5 is a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor.JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JMJD5

Key Reference: Imataka,H., (2007) Nat. Rev. Genet. 8 (11), 829-833

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lysine-specific demethylase 8

Protein Size: 416

Purification: Affinity Purified
More Information
SKU AVIARP58120_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58120_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 79831
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×