JMJD8 Antibody - middle region : Biotin

JMJD8 Antibody - middle region : Biotin
SKU
AVIARP58212_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The functions of LOC339123 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC339123

Key Reference: Daniels,R.J., (2001) Hum. Mol. Genet. 10 (4), 339-352

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: JmjC domain-containing protein 8

Protein Size: 285

Purification: Affinity Purified
More Information
SKU AVIARP58212_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58212_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 339123
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×