KDM7A Antibody - C region : Biotin

KDM7A Antibody - C region : Biotin
SKU
AVIARP58206_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human JHDM1D

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 106kDa

Peptide Sequence: Synthetic peptide located within the following region: CGYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: lysine-specific demethylase 7A

Protein Size: 941

Purification: Affinity Purified
More Information
SKU AVIARP58206_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58206_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 80853
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×