KIAA0692 Antibody - middle region : Biotin

KIAA0692 Antibody - middle region : Biotin
SKU
AVIARP55170_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0692

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 104kDa

Peptide Sequence: Synthetic peptide located within the following region: CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat and LEM domain-containing protein 2

Protein Size: 938

Purification: Affinity Purified
More Information
SKU AVIARP55170_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55170_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23141
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×