KIAA0892 Antibody - middle region : FITC

KIAA0892 Antibody - middle region : FITC
SKU
AVIARP55232_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0892

Key Reference: Seitan,V.C., PLoS Biol. 4 (8), E242 (2006)

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAU2 chromatid cohesion factor homolog

Protein Size: 613

Purification: Affinity Purified

Subunit: SCC4 homolog
More Information
SKU AVIARP55232_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55232_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23383
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×