KIAA1191 Antibody - middle region : HRP

KIAA1191 Antibody - middle region : HRP
SKU
AVIARP56290_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1191

Key Reference: Zuhlke,C., (1999) DNA Seq. 10 (1), 1-6

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative monooxygenase p33MONOX

Protein Size: 305

Purification: Affinity Purified
More Information
SKU AVIARP56290_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56290_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57179
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×