KIF5C Antibody - N-terminal region : Biotin

KIF5C Antibody - N-terminal region : Biotin
SKU
AVIARP54736_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5C

Key Reference: Cho,K.I., (2007) Traffic 8 (12), 1722-1735

Molecular Weight: 109kDa

Peptide Sequence: Synthetic peptide located within the following region: ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kinesin heavy chain isoform 5C

Protein Size: 957

Purification: Affinity Purified
More Information
SKU AVIARP54736_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54736_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Immunoprecipitation, Western Blotting
Human Gene ID 3800
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×