KIF5C Antibody - N-terminal region : FITC

KIF5C Antibody - N-terminal region : FITC
SKU
AVIARP54737_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5C

Key Reference: Cho,K.I., (2007) Traffic 8 (12), 1722-1735

Molecular Weight: 109kDa

Peptide Sequence: Synthetic peptide located within the following region: TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kinesin heavy chain isoform 5C

Protein Size: 957

Purification: Affinity Purified
More Information
SKU AVIARP54737_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54737_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3800
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×