KLF8 Antibody - N-terminal region : HRP

KLF8 Antibody - N-terminal region : HRP
SKU
AVIARP57952_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8

Key Reference: Wang,X., (2007) Cancer Res. 67 (15), 7184-7193

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Krueppel-like factor 8

Protein Size: 359

Purification: Affinity Purified
More Information
SKU AVIARP57952_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57952_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11279
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×