KLHDC4 Antibody - N-terminal region : FITC

KLHDC4 Antibody - N-terminal region : FITC
SKU
AVIARP56977_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLHDC4

Key Reference: Segade,F., (2007) Int. J. Biochem. Cell Biol. 39 (12), 2303-2313

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch domain-containing protein 4

Protein Size: 520

Purification: Affinity Purified
More Information
SKU AVIARP56977_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56977_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54758
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×