KLHL20 Antibody - C-terminal region : FITC

KLHL20 Antibody - C-terminal region : FITC
SKU
AVIARP55062_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the kelch family of proteins, which is characterized by a 44-56 amino acid repeat motif. The kelch motif appears in many different polypeptide contexts and contains multiple potential protein-protein contact sites. Members of this family are present both throughout the cell and extracellularly, with diverse activities.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KLHL20

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: NPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 20

Protein Size: 609

Purification: Affinity Purified
More Information
SKU AVIARP55062_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55062_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27252
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×