KLHL7 Antibody - middle region : FITC

KLHL7 Antibody - middle region : FITC
SKU
AVIARP56234_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLHL7

Key Reference: Bredholt,G., (2006) Scand. J. Immunol. 64 (3), 325-335

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 7

Protein Size: 564

Purification: Affinity Purified
More Information
SKU AVIARP56234_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56234_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55975
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×