KLK10 Antibody - N-terminal region : Biotin

KLK10 Antibody - N-terminal region : Biotin
SKU
AVIARP56451_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLK10

Key Reference: Kulasingam,V. (2007) Biol. Chem. 388 (10), 1113-1119

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kallikrein-10

Protein Size: 276

Purification: Affinity Purified
More Information
SKU AVIARP56451_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56451_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5655
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×