KLK10 Antibody - N-terminal region : HRP

KLK10 Antibody - N-terminal region : HRP
SKU
AVIARP56451_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLK10

Key Reference: Kulasingam,V. (2007) Biol. Chem. 388 (10), 1113-1119

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kallikrein-10

Protein Size: 276

Purification: Affinity Purified
More Information
SKU AVIARP56451_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56451_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5655
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×