KRAS Antibody - N-terminal region : FITC

KRAS Antibody - N-terminal region : FITC
SKU
AVIARP55408_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRAS

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTPase NRas

Protein Size: 189

Purification: Affinity Purified

Specificity#: 100% homologous to human KRAS, NRAS and HRAS.
More Information
SKU AVIARP55408_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55408_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3845
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×